Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARS2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Threonyl-tRNA synthetase 2, mitochondrial

Gene Aliases

COXPD21; TARSL1; threonine--tRNA ligase, mitochondrial; Threonyl-tRNA synthetase; threonyl-tRNA synthetase 2, mitochondrial (putative) ; threonyl-tRNA synthetase-like 1; thrRS.

Gene ID

80222

Accession Number

NP_001258825.1

Reactivity

Homo sapiens|Human

Target

Catalyzes the attachment of threonine to tRNA (Thr) in a two-step reaction: threonine is first activated by ATP to form Thr-AMP and then transferred to the acceptor end of tRNA (Thr) . Also edits incorrectly charged tRNA (Thr) via its editing domain.

Type

Protein

Source

E.coli

Sequence

EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TARS2

Host or Source

Human

Protein Name

Threonine--tRNA ligase, mitochondrial

Gene Name URL

TARS2

Nucleotide Accession Number

NM_001271896.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r102 3'UTR GFP Stable Cell Line
TU171989 1.0 mL

Vmn2r102 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Apelin Antibody
MBS5312813-01 0.1 mg

Apelin Antibody

Sign In for Pricing
View Details
Apelin Antibody
MBS5312813-02 5x 0.1 mg

Apelin Antibody

Sign In for Pricing
View Details
CD301 (CD301 Antigen, C-type Lectin Domain Family 10 Member A, CLEC10A, CLECSF13, C-type Lectin Superfamily Member 14, CLECSF14, HML2, Macrophage Lectin 2) (MaxLight 750) discontinued
C2549-29A-ML750 100 µL

CD301 (CD301 Antigen, C-type Lectin Domain Family 10 Member A, CLEC10A, CLECSF13, C-type Lectin Superfamily Member 14, CLECSF14, HML2, Macrophage Lectin 2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human PNPLA7 qPCR Primer Pair
QH74793S 200 Tests

Human PNPLA7 qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Ezrin Antibody
MBS820128-01 0.03 mL

Anti-Ezrin Antibody

Sign In for Pricing
View Details