Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRP19 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Signal recognition particle 19

Gene Aliases

Signal recognition particle 19 kDa protein; signal recognition particle 19kD; signal recognition particle 19kDa.

Gene ID

6728

Accession Number

NP_001191122.1

Reactivity

Homo sapiens|Human

Target

Signal-recognition-particle assembly, binds directly to 7S RNA and mediates binding of the 54 kDa subunit of the SRP.

Type

Protein

Source

E.coli

Sequence

ACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQKTGGADQSLQQGEGSKKGKGKKKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

32 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SRP19

Host or Source

Human

Protein Name

Signal recognition particle 19 kDa protein

Gene Name URL

SRP19

Nucleotide Accession Number

NM_001204193.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GADL1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-13264R-BF555 100 µL

GADL1 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Anti-6X His - 70nm Gold Conjugate
AC-70-21-05 0.5 mL

Anti-6X His - 70nm Gold Conjugate

Sign In for Pricing
View Details
Lentiviral mouse Tmtc2 shRNA (UAS) - Lentiviral mouse Tmtc2 shRNA (UAS, iRFP) (100)
GTR15179607 1 Vial

Lentiviral mouse Tmtc2 shRNA (UAS) - Lentiviral mouse Tmtc2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CPS1, NT (CPS1, Carbamoyl-phosphate synthase [ammonia], mitochondrial, Carbamoyl-phosphate synthetase I) (MaxLight 405)
MBS6288400-01 0.1 mL

CPS1, NT (CPS1, Carbamoyl-phosphate synthase [ammonia], mitochondrial, Carbamoyl-phosphate synthetase I) (MaxLight 405)

Sign In for Pricing
View Details
CPS1, NT (CPS1, Carbamoyl-phosphate synthase [ammonia], mitochondrial, Carbamoyl-phosphate synthetase I) (MaxLight 405)
MBS6288400-02 5x 0.1 mL

CPS1, NT (CPS1, Carbamoyl-phosphate synthase [ammonia], mitochondrial, Carbamoyl-phosphate synthetase I) (MaxLight 405)

Sign In for Pricing
View Details
LYAR Polyclonal Antibody
41115-01 50 µL

LYAR Polyclonal Antibody

Sign In for Pricing
View Details