Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Socs3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Suppressor of cytokine signaling 3

Gene Aliases

Cish3; cytokine inducible SH2-containing protein 3; cytokine-inducible SH2 protein 3; Socs-3; Ssi-3; suppressor of cytokine signaling 3.

Gene ID

89829

Accession Number

NP_446017.1

Reactivity

Rat|Rattus norvegicus

Target

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS3 is involved in negative regulation of cytokines that signal through the JAK/STAT pathway. Inhibits cytokine signal transduction by binding to tyrosine kinase receptors including gp130, LIF, erythropoietin, insulin, IL12, GCSF and leptin receptors. Binding to JAK2 inhibits its kinase activity. Suppresses fetal liver erythropoiesis. Regulates onset and maintenance of allergic responses mediated by T-helper type 2 cells. Regulates IL-6 signaling in vivo. Probable substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Seems to recognize IL6ST (By similarity) .

Type

Protein

Source

E.coli

Sequence

MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVETQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFSLPPTEPSFEVQEQPPAQALPGGTPKRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Socs3

Host or Source

Rat

Protein Name

Suppressor of cytokine signaling 3

Gene Name URL

Socs3

Nucleotide Accession Number

NM_053565.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Texas Red Conjugated Goat Affinity Purified Antibody to Cat IgG Antibody
TAF-421-1 1 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Cat IgG Antibody

Sign In for Pricing
View Details
ZNF32 (NM_001005368) Human Over-expression Lysate
LY423703 100 µg

ZNF32 (NM_001005368) Human Over-expression Lysate

Sign In for Pricing
View Details
p53 (TP53) pThr55 Rabbit Polyclonal Antibody
AP12907PU-N 400 µL

p53 (TP53) pThr55 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human IGFBP-1, Tag Free
HA211115-01 20 µg

Human IGFBP-1, Tag Free

Sign In for Pricing
View Details
Human IGFBP-1, Tag Free
HA211115-02 50 µg

Human IGFBP-1, Tag Free

Sign In for Pricing
View Details
Human IGFBP-1, Tag Free
HA211115-03 100 µg

Human IGFBP-1, Tag Free

Sign In for Pricing
View Details