Slc1a2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Solute carrier family 1 (glial high affinity glutamate transporter), member 2

Gene Aliases

1700091C19Rik;2900019G14Rik; AI159670; Eaa; Eaat2; EAAT2 variant mEAAT2/5UT2; EAAT2 variant mEAAT2/5UT5; excitatory amino acid transporter 2; GLT; GLT-; GLT1; GLT-1; glutamate transporter 1c; MGLT; MGLT1; sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2; solute carrier family 1, member 2.

Gene ID

20511

Accession Number

NP_001070982.1

Reactivity

Mouse|Mus musculus

Target

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7698742, PubMed:7557442, PubMed:9373176) . Functions as a symporter that transports one amino acid molecule together with two or three Na (+) ions and one proton, in parallel with the counter-transport of one K (+) ion. Mediates Cl (-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na (+) symport (By similarity) . Essential for the rapid removal of released glutamate from the synaptic cleft, and for terminating the postsynaptic action of glutamate (PubMed:9180080) .

Type

Protein

Source

E.coli

Sequence

HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.