What is the catalog number for Slc1a2 Recombinant Protein?

The catalog number for Slc1a2 Recombinant Protein is OPCA01857-100UG.

What sizes are available for Slc1a2 Recombinant Protein?

Slc1a2 Recombinant Protein is available in the following size(s): 100 µg.

Is Slc1a2 Recombinant Protein in stock?

Slc1a2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Slc1a2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Solute carrier family 1 (glial high affinity glutamate transporter), member 2

Gene Aliases

1700091C19Rik;2900019G14Rik; AI159670; Eaa; Eaat2; EAAT2 variant mEAAT2/5UT2; EAAT2 variant mEAAT2/5UT5; excitatory amino acid transporter 2; GLT; GLT-; GLT1; GLT-1; glutamate transporter 1c; MGLT; MGLT1; sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2; solute carrier family 1, member 2.

Gene ID

20511

Accession Number

NP_001070982.1

Reactivity

Mouse|Mus musculus

Target

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:7698742, PubMed:7557442, PubMed:9373176) . Functions as a symporter that transports one amino acid molecule together with two or three Na (+) ions and one proton, in parallel with the counter-transport of one K (+) ion. Mediates Cl (-) flux that is not coupled to amino acid transport; this avoids the accumulation of negative charges due to aspartate and Na (+) symport (By similarity) . Essential for the rapid removal of released glutamate from the synaptic cleft, and for terminating the postsynaptic action of glutamate (PubMed:9180080) .

Type

Protein

Source

E.coli

Sequence

HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Slc1a2

Host or Source

Mouse

Protein Name

Excitatory amino acid transporter 2

Gene Name URL

Slc1a2

Nucleotide Accession Number

NM_001077514.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC550322-100 1x 100 µL