Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIRPD Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Signal regulatory protein delta

Gene Aliases

DJ576H24.4; Protein tyrosine phosphatase non-receptor type substrate 1-like 2; protein tyrosine phosphatase, non-receptor type substrate 1-like 2; PTPNS1L2; signal-regulatory protein delta; SIRP-delta.

Gene ID

128646

Accession Number

NP_848555.2

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

FHVQQTEMSQTVSTGESIILSCSVPNTLPNGPVLWFKGTGPNRKLIYNFKQGNFPRVKEIGDTTKPGNTDFSTRIREISLADAGTYYCVKFIKGRAIKEYQSGRGTQVFVTEQNPRPPKNRPAGRAGSRAHHDAHTCLSALPERNSTNYFVQPCCCLRLLGLTGLLSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SIRPD

Host or Source

Human

Protein Name

Signal-regulatory protein delta

Gene Name URL

SIRPD

Nucleotide Accession Number

NM_178460.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

NHSL1, ID (NHSL1, C6orf63, KIAA1357, NHS-like protein 1) (MaxLight 650) discontinued
038966-ML650 100 µL

NHSL1, ID (NHSL1, C6orf63, KIAA1357, NHS-like protein 1) (MaxLight 650) discontinued

Sign In for Pricing
View Details
MNT Antibody - N-terminal region : FITC (ARP39412_P050-FITC)
ARP39412_P050-FITC 100 µL

MNT Antibody - N-terminal region : FITC (ARP39412_P050-FITC)

Sign In for Pricing
View Details
SSH3 (phospho-Ser37) rabbit pAb
UB-GEN-14386 100 µL

SSH3 (phospho-Ser37) rabbit pAb

Sign In for Pricing
View Details
Lce1c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3177606 1.0 µg DNA

Lce1c sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
NR1D2 (Nuclear Receptor Subfamily 1 Group D Member 2, Orphan Nuclear Hormone Receptor BD73, Rev-erb-beta, V-erbA-related Protein 1-related) APC
MBS6137944-01 0.1 mL

NR1D2 (Nuclear Receptor Subfamily 1 Group D Member 2, Orphan Nuclear Hormone Receptor BD73, Rev-erb-beta, V-erbA-related Protein 1-related) APC

Sign In for Pricing
View Details
NR1D2 (Nuclear Receptor Subfamily 1 Group D Member 2, Orphan Nuclear Hormone Receptor BD73, Rev-erb-beta, V-erbA-related Protein 1-related) APC
MBS6137944-02 5x 0.1 mL

NR1D2 (Nuclear Receptor Subfamily 1 Group D Member 2, Orphan Nuclear Hormone Receptor BD73, Rev-erb-beta, V-erbA-related Protein 1-related) APC

Sign In for Pricing
View Details