Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCP2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Sterol carrier protein 2

Gene Aliases

Acetyl-CoA C-myristoyltransferase; epididymis secretory sperm binding protein; NLTP; non-specific lipid-transfer protein; NSL-TP; propanoyl-CoA C-acyltransferase; SCOX; SCP-2; SCP-2/3-oxoacyl-CoA thiolase; SCP-2/thiolase; SCP-CHI; SCPX; SCP-X; sterol carrier protein 2; sterol carrier protein X; straight-chain acyl-CoA oxidase.

Gene ID

6342

Accession Number

NP_001007099.1

Reactivity

Homo sapiens|Human

Target

Mediates in vitro the transfer of all common phospholipids, cholesterol and gangliosides between membranes. May play a role in regulating steroidogenesis.

Type

Protein

Source

E.coli

Sequence

MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEEGEQFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPNSDKKADCTITMADSDFLALMTGKMNPQSAFFQGKLKITGNMGLAMKLQNLQLQPGNAKL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SCP2

Host or Source

Human

Protein Name

Non-specific lipid-transfer protein

Gene Name URL

SCP2

Nucleotide Accession Number

NM_001007098.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSD17B14 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
23935064 1.0 µg DNA

HSD17B14 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
NSDHL Rabbit mAb
AB101586 100 µL

NSDHL Rabbit mAb

Sign In for Pricing
View Details
Rabbit anti-human Protein atonal homolog 1 polyclonal Antibody
MBS1492828-01 0.05 mg

Rabbit anti-human Protein atonal homolog 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Protein atonal homolog 1 polyclonal Antibody
MBS1492828-02 0.1 mg

Rabbit anti-human Protein atonal homolog 1 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human Protein atonal homolog 1 polyclonal Antibody
MBS1492828-03 5x 0.1 mg

Rabbit anti-human Protein atonal homolog 1 polyclonal Antibody

Sign In for Pricing
View Details
Ms4a1 siRNA Oligos set (Rat)
30697176 3x 5 nmol

Ms4a1 siRNA Oligos set (Rat)

Sign In for Pricing
View Details