What is the catalog number for S100A6 Recombinant Protein?

The catalog number for S100A6 Recombinant Protein is OPCA01831-100UG.

What sizes are available for S100A6 Recombinant Protein?

S100A6 Recombinant Protein is available in the following size(s): 100 µg.

Is S100A6 Recombinant Protein in stock?

S100A6 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

S100A6 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

S100 calcium binding protein A6

Gene Aliases

2A9;5B10; CABP; CACY; calcyclin; growth factor-inducible protein 2A9; MLN 4; PRA; prolactin receptor-associated protein; protein S100-A6; S100 calcium-binding protein A6; S10A6.

Gene ID

6277

Accession Number

NP_055439.1

Reactivity

Homo sapiens|Human

Target

May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Type

Protein

Source

E.coli

Sequence

MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.