Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg3g Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Regenerating family member 3 gamma

Gene Aliases

Pancreatitis-associated protein 3; Pap3; PAPIII; reg III-gamma; REG-3-gamma; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; regenerating islet-derived protein III-gamma.

Gene ID

24620

Accession Number

NP_775120.1

Reactivity

Rat|Rattus norvegicus

Target

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury (By similarity) .

Type

Protein

Source

E.coli

Sequence

EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Reg3g

Host or Source

Rat

Protein Name

Regenerating islet-derived protein 3-gamma

Gene Name URL

Reg3g

Nucleotide Accession Number

NM_173097.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Polyclonal Retinol Binding Protein Antibody
B2019284 0.25 mg

Biotinylated Polyclonal Retinol Binding Protein Antibody

Sign In for Pricing
View Details
Mouse High density lipoprotein (HDL) ELISA Kit
MBS2801696-01 48 Tests

Mouse High density lipoprotein (HDL) ELISA Kit

Sign In for Pricing
View Details
Mouse High density lipoprotein (HDL) ELISA Kit
MBS2801696-02 96 Tests

Mouse High density lipoprotein (HDL) ELISA Kit

Sign In for Pricing
View Details
Mouse High density lipoprotein (HDL) ELISA Kit
MBS2801696-03 5x 96 Tests

Mouse High density lipoprotein (HDL) ELISA Kit

Sign In for Pricing
View Details
Mouse High density lipoprotein (HDL) ELISA Kit
MBS2801696-04 10x 96 Tests

Mouse High density lipoprotein (HDL) ELISA Kit

Sign In for Pricing
View Details
Smurf2 (C-5) : m-IgG Fc BP-HRP Bundle
sc-550676 1 Kit

Smurf2 (C-5) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details