Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reg3g Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Regenerating family member 3 gamma

Gene Aliases

Pancreatitis-associated protein 3; Pap3; PAPIII; reg III-gamma; REG-3-gamma; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; regenerating islet-derived protein III-gamma.

Gene ID

24620

Accession Number

NP_775120.1

Reactivity

Rat|Rattus norvegicus

Target

Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury (By similarity) .

Type

Protein

Source

E.coli

Sequence

EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

20.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Reg3g

Host or Source

Rat

Protein Name

Regenerating islet-derived protein 3-gamma

Gene Name URL

Reg3g

Nucleotide Accession Number

NM_173097.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMAD2 Rabbit Polyclonal Antibody
TA392506 100 µL

SMAD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), 0.2mg/mL
BNUB1209-100 1x 100 µL

CD45RO (UCHL1 + T200/797), 0.2mg/mL

Sign In for Pricing
View Details
GI24 (C10orf54) (NM_022153) Human Recombinant Protein
TP304547 20 µg

GI24 (C10orf54) (NM_022153) Human Recombinant Protein

Sign In for Pricing
View Details
Lipid Peroxide (LPO) Colorimetric Assay Kit
E-BC-K176-M-01 48 T (32 samples)

Lipid Peroxide (LPO) Colorimetric Assay Kit

Sign In for Pricing
View Details
Lipid Peroxide (LPO) Colorimetric Assay Kit
E-BC-K176-M-02 96 T (80 samples)

Lipid Peroxide (LPO) Colorimetric Assay Kit

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1892), 0.2mg/mL
BNUB1892-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1892), 0.2mg/mL

Sign In for Pricing
View Details