Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH11 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Retinol dehydrogenase 11

Gene Aliases

Androgen-regulated short-chain dehydrogenase/reductase 1; ARSDR1; CGI82; HCBP12; HCV core-binding protein HCBP12; MDT1; prostate short-chain dehydrogenase reductase 1; Prostate short-chain dehydrogenase/reductase 1; PSDR1; RALR1; RDJCSS; retinal reductase 1; retinol dehydrogenase 11; retinol dehydrogenase 11 (all-trans/9-cis/11-cis) ; SCALD; SDR7C1; Short chain dehydrogenase/reductase family 7C member 1; short chain dehydrogenase/reductase family 7C, member 1.

Gene ID

51109

Accession Number

NP_001239579.1

Reactivity

Homo sapiens|Human

Target

Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.

Type

Protein

Source

E.coli

Sequence

PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RDH11

Host or Source

Human

Protein Name

Retinol dehydrogenase 11

Gene Name URL

RDH11

Nucleotide Accession Number

NM_001252650.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide
WWC89166-01 10 mg

N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide

Sign In for Pricing
View Details
N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide
WWC89166-02 25 mg

N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide

Sign In for Pricing
View Details
N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide
WWC89166-03 50 mg

N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide

Sign In for Pricing
View Details
N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide
WWC89166-04 100 mg

N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide

Sign In for Pricing
View Details
N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide
WWC89166-05 250 mg

N- (2,5-diaza-2- (2- (2-methylphenyl) -2-oxoethyl) -3-oxo-6-phenylbicyclo[5.4.0]undeca-1 (7),5,8,10-tetraen-4-yl) ((4-methyl-3-nitrophenyl) amino) formamide

Sign In for Pricing
View Details
Rabbit Polyclonal TMEM65 Antibody [Alexa Fluor 405]
NBP2-98148AF405 0.1 mL

Rabbit Polyclonal TMEM65 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details