Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RDH11 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Retinol dehydrogenase 11

Gene Aliases

Androgen-regulated short-chain dehydrogenase/reductase 1; ARSDR1; CGI82; HCBP12; HCV core-binding protein HCBP12; MDT1; prostate short-chain dehydrogenase reductase 1; Prostate short-chain dehydrogenase/reductase 1; PSDR1; RALR1; RDJCSS; retinal reductase 1; retinol dehydrogenase 11; retinol dehydrogenase 11 (all-trans/9-cis/11-cis) ; SCALD; SDR7C1; Short chain dehydrogenase/reductase family 7C member 1; short chain dehydrogenase/reductase family 7C, member 1.

Gene ID

51109

Accession Number

NP_001239579.1

Reactivity

Homo sapiens|Human

Target

Exhibits an oxidoreductive catalytic activity towards retinoids. Most efficient as an NADPH-dependent retinal reductase. Displays high activity towards 9-cis and all-trans-retinol. Also involved in the metabolism of short-chain aldehydes. No steroid dehydrogenase activity detected.

Type

Protein

Source

E.coli

Sequence

PQIRKMLSSGVCTSTVQLPGKVVVVTGANTGIGKETAKELAQRGARVYLACRDVEKGELVAKEIQTTTGNQQVLVRKLDLSDTKSIRAFAKGFLAEEKHLHVLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKLKESAPSRIVNVSSLAHHLGRIHFHNLQGEKFYNAGLAYCHSKLANILFTQELARRLKGSGVTTYSVHPGTVQSELVRHSSFMRWMWWLFSFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIARRLWDVSCDLLGLPID

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RDH11

Host or Source

Human

Protein Name

Retinol dehydrogenase 11

Gene Name URL

RDH11

Nucleotide Accession Number

NM_001252650.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Htr3b Mouse shRNA Plasmid (Locus ID 57014)
TR509634 1 Kit

Htr3b Mouse shRNA Plasmid (Locus ID 57014)

Sign In for Pricing
View Details
GFP-Human Dermal Microvascular Endothelial Cells
ABC-FC0009 1 Vial

GFP-Human Dermal Microvascular Endothelial Cells

Sign In for Pricing
View Details
PITPNC1 (NM_012417) Human Tagged ORF Clone Lentiviral Particle
RC211401L4V 200 µL

PITPNC1 (NM_012417) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Nfkbie (NM_008690) Mouse Tagged Lenti ORF Clone
MR205604L4 10 µg

Nfkbie (NM_008690) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MFSD2A CRISPRa sgRNA lentivector (set of three targets)(Mouse)
28454124 3x 1.0µg DNA

MFSD2A CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Zfp277 (NM_172575) AAV Particle
MR224030A1V 250 µL

Mouse Zfp277 (NM_172575) AAV Particle

Sign In for Pricing
View Details