Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBP3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Retinol binding protein 3

Gene Aliases

7S protein; interphotoreceptor retinoid-binding protein; interstitial retinol-binding protein; IRBP; protein 7S; retinol binding protein 3, interstitial; retinol-binding protein 3.

Gene ID

281443

Accession Number

NP_002891.1

Reactivity

Bos taurus|Bovine

Target

IRBP shuttles 11-cis and all trans retinoids between the retinol isomerase in the pigment epithelium and the visual pigments in the photoreceptor cells of the retina.

Type

Protein

Source

E.coli

Sequence

AKVPTVLQTAGKLVADNYASPELGVKMAAELSGLQSRYARVTSEAALAELLQADLQVLSGDPHLKTAHIPEDAKDRIPGIVPMQIPSPEVFEDLIKFSFHTNVLEGNVGYLRFDMFGDCELLTQVSELLVEHVWKKIVHTDALIVDMRFNIGGPTSSISALCSYFFDEGPPILLDKIYNRPNNSVSELWTLSQLEGERYGSKKSMVILTSTLTAGAAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTDLYLTIPTARSVGAADGSSWEGVGVVPDVAVPAEAALTRAQEMLQHT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RBP3

Host or Source

Bovine

Protein Name

Retinol-binding protein 3

Gene Name URL

RBP3

Nucleotide Accession Number

NM_002900.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Fibroblast Growth Factor 11 ELISA Kit
MBS103665-01 48 Well

Hamster Fibroblast Growth Factor 11 ELISA Kit

Sign In for Pricing
View Details
Hamster Fibroblast Growth Factor 11 ELISA Kit
MBS103665-02 96 Well

Hamster Fibroblast Growth Factor 11 ELISA Kit

Sign In for Pricing
View Details
Hamster Fibroblast Growth Factor 11 ELISA Kit
MBS103665-03 5x 96 Well

Hamster Fibroblast Growth Factor 11 ELISA Kit

Sign In for Pricing
View Details
Hamster Fibroblast Growth Factor 11 ELISA Kit
MBS103665-04 10x 96 Well

Hamster Fibroblast Growth Factor 11 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Smim11 shRNA (UAS) - Lentiviral mouse Smim11 shRNA (UAS, iRFP) (25)
GTR15252338 1 Vial

Lentiviral mouse Smim11 shRNA (UAS) - Lentiviral mouse Smim11 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
BMP61 AM Proprietary Brady Systems
146229 Pack of 1 Piece(s)

BMP61 AM Proprietary Brady Systems

Sign In for Pricing
View Details