Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

RNA binding motif protein 3

Gene Aliases

IS1-RNPL; RNA binding motif (RNP1, RRM) protein 3; RNA-binding motif protein 3; RNA-binding protein 3; RNPL.

Gene ID

5935

Accession Number

NP_006734.1

Reactivity

Homo sapiens|Human

Target

Cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. Reduces the relative abundance of microRNAs, when overexpressed. Enhances phosphorylation of translation initiation factors and active polysome formation (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RBM3

Host or Source

Human

Protein Name

RNA-binding protein 3

Gene Name URL

RBM3

Nucleotide Accession Number

NM_006743.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRNA (mRNA-capping Enzyme, HCAP1, HCE, RNGTT, CAP1A) (HRP)
MBS6269818-01 0.1 mL

MRNA (mRNA-capping Enzyme, HCAP1, HCE, RNGTT, CAP1A) (HRP)

Sign In for Pricing
View Details
MRNA (mRNA-capping Enzyme, HCAP1, HCE, RNGTT, CAP1A) (HRP)
MBS6269818-02 5x 0.1 mL

MRNA (mRNA-capping Enzyme, HCAP1, HCE, RNGTT, CAP1A) (HRP)

Sign In for Pricing
View Details
DNAJB1 Protein Lysate (Mouse) with C-HA Tag
18375034 100 µg

DNAJB1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
WT1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6983R-BF750-TR 20 µL

WT1 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
GRIK1 Goat Polyclonal Antibody
TA303274 100 µg

GRIK1 Goat Polyclonal Antibody

Sign In for Pricing
View Details
FLJ20643 (PIH1 Domain Containing 1, FLJ20643, NOP17) (HRP)
MBS6179641-01 0.1 mL

FLJ20643 (PIH1 Domain Containing 1, FLJ20643, NOP17) (HRP)

Sign In for Pricing
View Details