Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QPCT Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutaminyl-peptide cyclotransferase

Gene Aliases

EC; GCT; glutaminyl cyclase; glutaminyl-peptide cyclotransferase; glutaminyl-tRNA cyclotransferase; glutamyl cyclase; QC; sQC.

Gene ID

25797

Accession Number

NP_036545.1

Reactivity

Homo sapiens|Human

Target

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-amyloid-beta. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.

Type

Protein

Source

E.coli

Sequence

VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

QPCT

Host or Source

Human

Protein Name

Glutaminyl-peptide cyclotransferase

Gene Name URL

QPCT

Nucleotide Accession Number

NM_012413.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat LCAT (Lecithin Cholesterol Acyltransferase) ELISA Kit
ER21829 96 Tests

Rat LCAT (Lecithin Cholesterol Acyltransferase) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 12, IL-12 ELISA Kit
YLA0670HU-01 48 Tests

Human Interleukin 12, IL-12 ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 12, IL-12 ELISA Kit
YLA0670HU-02 96 Tests

Human Interleukin 12, IL-12 ELISA Kit

Sign In for Pricing
View Details
CTRL shRNA (h) Lentiviral Particles
sc-93314-V 200 µL

CTRL shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
TRAF4 (TNF Receptor Associated Factor 4, TNF Receptor-associated Factor 4, TRAF 4, TRAF-4, Cysteine-rich Domain Associated with RING and Traf Domains Protein 1, CART1, Metastatic Lymph Node Gene 62 Protein, MLN 62, MLN62, RING Finger Protein 83, RNF83) (MaxLight 405) discontinued
134674-ML405 100 µL

TRAF4 (TNF Receptor Associated Factor 4, TNF Receptor-associated Factor 4, TRAF 4, TRAF-4, Cysteine-rich Domain Associated with RING and Traf Domains Protein 1, CART1, Metastatic Lymph Node Gene 62 Protein, MLN 62, MLN62, RING Finger Protein 83, RNF83) (MaxLight 405) discontinued

Sign In for Pricing
View Details
MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (MaxLight 490)
MBS6201790-01 0.1 mL

MCF2L (DRG, KIAA0861, Probable Guanine Nucleotide Exchange Factor MCF2L2, Dbs-related Rho Family Guanine Nucleotide Exchange Factor, MCF2-transforming Sequence-like Protein 2) (MaxLight 490)

Sign In for Pricing
View Details