Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QPCT Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutaminyl-peptide cyclotransferase

Gene Aliases

EC; GCT; glutaminyl cyclase; glutaminyl-peptide cyclotransferase; glutaminyl-tRNA cyclotransferase; glutamyl cyclase; QC; sQC.

Gene ID

25797

Accession Number

NP_036545.1

Reactivity

Homo sapiens|Human

Target

Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-amyloid-beta. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides.

Type

Protein

Source

E.coli

Sequence

VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

QPCT

Host or Source

Human

Protein Name

Glutaminyl-peptide cyclotransferase

Gene Name URL

QPCT

Nucleotide Accession Number

NM_012413.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDHA1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]
TA502696BM 100 µL

PDHA1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C10]

Sign In for Pricing
View Details
MTND1P18 Protein Lysate (Human) with C-Ha Tag
30926031 100 µg

MTND1P18 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Anti-Phospho-TrkC (Tyr516) Polyclonal Antibody
TMAC-04129-01 50 μL

Anti-Phospho-TrkC (Tyr516) Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Phospho-TrkC (Tyr516) Polyclonal Antibody
TMAC-04129-02 100 µL

Anti-Phospho-TrkC (Tyr516) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral human NDUFS2 shRNA (UAS) - Lentiviral human NDUFS2 shRNA (UAS, GFP) plasmid
GTR15105178 1 Vial

Lentiviral human NDUFS2 shRNA (UAS) - Lentiviral human NDUFS2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
HisRS CRISPR Activation Plasmid (m)
sc-420796-ACT 20 µg

HisRS CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details