Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein tyrosine phosphatase non-receptor type 5

Gene Aliases

Neural-specific protein-tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) ; protein-tyrosine phosphatase striatum-enriched; PTPSTEP; STEP; STEP61; striatal-enriched protein tyrosine phosphatase; striatum-enriched protein-tyrosine phosphatase; tyrosine-protein phosphatase non-receptor type 5.

Gene ID

84867

Accession Number

NP_001035059.1

Reactivity

Homo sapiens|Human

Target

May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.

Type

Protein

Source

E.coli

Sequence

LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTPN5

Host or Source

Human

Protein Name

RecName: Full=Tyrosine-protein phosphatase non-receptor type 5; AltName: Full=Neural-specific protein-tyrosine phosphatase; AltName: Full=Striatum-enriched protein-tyrosine phosphatase; Short=STEP|Tyrosine-protein phosphatase non-receptor type 5

Gene Name URL

PTPN5

Nucleotide Accession Number

NM_001039970.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOM1 antibody - middle region
MBS3210589-01 0.1 mL

TOM1 antibody - middle region

Sign In for Pricing
View Details
TOM1 antibody - middle region
MBS3210589-02 5x 0.1 mL

TOM1 antibody - middle region

Sign In for Pricing
View Details
AdmiRa-hsa-miR-219a-2-3p-Off Virus
mh5350 1.0 mL

AdmiRa-hsa-miR-219a-2-3p-Off Virus

Sign In for Pricing
View Details
Monkey Arginine/serine-rich protein PNISR (SFRS18) ELISA Kit
MBS7248347-01 48 Well

Monkey Arginine/serine-rich protein PNISR (SFRS18) ELISA Kit

Sign In for Pricing
View Details
Monkey Arginine/serine-rich protein PNISR (SFRS18) ELISA Kit
MBS7248347-02 96 Well

Monkey Arginine/serine-rich protein PNISR (SFRS18) ELISA Kit

Sign In for Pricing
View Details
Monkey Arginine/serine-rich protein PNISR (SFRS18) ELISA Kit
MBS7248347-03 5x 96 Well

Monkey Arginine/serine-rich protein PNISR (SFRS18) ELISA Kit

Sign In for Pricing
View Details