What is the catalog number for PTPN5 Recombinant Protein?

The catalog number for PTPN5 Recombinant Protein is OPCA01807-100UG.

What sizes are available for PTPN5 Recombinant Protein?

PTPN5 Recombinant Protein is available in the following size(s): 100 µg.

Is PTPN5 Recombinant Protein in stock?

PTPN5 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request additional validation data, such as western blot images, for this product?

Additional data may be available on request. Contact our technical support team with the catalogue number and we’ll check what supporting documentation the supplier can provide.

What documentation should I request if this product is used for a regulated or intellectual-property-sensitive application?

If the product is subject to intellectual property protections, we’ll advise on any MTA or usage restrictions before shipping. Let us know your intended end use so we can confirm what’s required upfront.

Is this antibody conjugated?

Conjugation status, such as unconjugated, HRP, FITC, or biotin, is specified in the product name and confirmed on the datasheet.

PTPN5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein tyrosine phosphatase non-receptor type 5

Gene Aliases

Neural-specific protein-tyrosine phosphatase; protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) ; protein-tyrosine phosphatase striatum-enriched; PTPSTEP; STEP; STEP61; striatal-enriched protein tyrosine phosphatase; striatum-enriched protein-tyrosine phosphatase; tyrosine-protein phosphatase non-receptor type 5.

Gene ID

84867

Accession Number

NP_001035059.1

Reactivity

Homo sapiens|Human

Target

May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.

Type

Protein

Source

E.coli

Sequence

LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTPN5

Host or Source

Human

Protein Name

RecName: Full=Tyrosine-protein phosphatase non-receptor type 5; AltName: Full=Neural-specific protein-tyrosine phosphatase; AltName: Full=Striatum-enriched protein-tyrosine phosphatase; Short=STEP|Tyrosine-protein phosphatase non-receptor type 5

Gene Name URL

PTPN5

Nucleotide Accession Number

NM_001039970.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

BNC042848-500 1x 500 µL