Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTH2R Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Parathyroid hormone 2 receptor

Gene Aliases

Parathyroid hormone 2 receptor; parathyroid hormone receptor 2; PTH2 receptor; PTHR2.

Gene ID

5746

Accession Number

NP_001296445.1

Reactivity

Homo sapiens|Human

Target

This is a specific receptor for parathyroid hormone. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. PTH2R may be responsible for PTH effects in a number of physiological systems. It may play a significant role in pancreatic function. PTH2R presence in neurons indicates that it may function as a neurotransmitter receptor (By similarity) .

Type

Protein

Source

E.coli

Sequence

DSDGTITIEEQIVLVLKAKVQCELNITAQLQEGEGNCFPEWDGLICWPRGTVGKISAVPCPPYIYDFNHKGVAFRHCNPNGTWDFMHSLNKTWANYSDCLRFLQPDISIGKQEFFERLY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PTH2R

Host or Source

Human

Protein Name

Parathyroid hormone 2 receptor

Gene Name URL

PTH2R

Nucleotide Accession Number

NM_001309516.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSV Antibody
orb1087528 1 mg

RSV Antibody

Sign In for Pricing
View Details
Recombinant Human CD258/TNFSF14/LIGHT Protein, N-His
HT145012-01 50 µg

Recombinant Human CD258/TNFSF14/LIGHT Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD258/TNFSF14/LIGHT Protein, N-His
HT145012-02 100 µg

Recombinant Human CD258/TNFSF14/LIGHT Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD258/TNFSF14/LIGHT Protein, N-His
HT145012-03 1 mg

Recombinant Human CD258/TNFSF14/LIGHT Protein, N-His

Sign In for Pricing
View Details
MAML3 Rabbit Polyclonal Antibody (Biotin)
orb2899727 100 µg

MAML3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Anti-Collagen IV COL4A1 Antibody Picoband® (monoclonal, 3G3) (Dylight488 Conjugate)
M01411-Dylight488 100 µg

Anti-Collagen IV COL4A1 Antibody Picoband® (monoclonal, 3G3) (Dylight488 Conjugate)

Sign In for Pricing
View Details