Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prnp Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Prion protein

Gene Aliases

Major prion protein; prion protein, PrP; prion protein, structural; Prn; PrP.

Gene ID

24686

Accession Number

NP_036763.1

Reactivity

Rat|Rattus norvegicus

Target

Its primary physiological function is unclear. May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May promote myelin homeostasis through acting as an agonist for ADGRG6 receptor. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro) (By similarity) . Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu (2+) or ZN (2+) for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains (By similarity) .

Type

Protein

Source

E.coli

Sequence

GGWNTGGSRYPGQGSPGGNRYPPQSGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWSQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMLHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Prnp

Host or Source

Rat

Protein Name

Major prion protein

Gene Name URL

Prnp

Nucleotide Accession Number

NM_012631.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

0.5ppm Fluoride Std - 5L
WTRF055 5 L

0.5ppm Fluoride Std - 5L

Sign In for Pricing
View Details
Anti-MSLNL Antibody Picoband®, FITC Conjugate
A17693-FITC 100 µg/Vial

Anti-MSLNL Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)
MBS1152434-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)
MBS1152434-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)
MBS1152434-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)
MBS1152434-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 15 protein (mug15)

Sign In for Pricing
View Details