What is the catalog number for PRKRIR Recombinant Protein?

The catalog number for PRKRIR Recombinant Protein is OPCA01797-1MG.

What sizes are available for PRKRIR Recombinant Protein?

PRKRIR Recombinant Protein is available in the following size(s): 1 mg.

Is PRKRIR Recombinant Protein in stock?

PRKRIR Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

What applications has this product been validated for?

Validated applications such as WB, ELISA, IHC, ICC, or FC are listed on the product datasheet. If you need application-specific validation data before ordering, contact our technical support team with the catalogue number.

How do I reconstitute this lyophilized product?

Reconstitution instructions, including the recommended diluent and final concentration, are provided on the datasheet. Aliquot immediately after reconstitution to avoid repeated freeze-thaw cycles.

PRKRIR Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

THAP domain containing 12

Gene Aliases

52 kDa repressor of the inhibitor of the protein kinase;58 kDa interferon-induced protein kinase-interacting protein; DAP4; death-associated protein 4; inhibitor of protein kinase PKR; P52rIPK; p58IPK-interacting protein; P58IPK-regulatory protein; PRKRIR; protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) ; testicular tissue protein Li 133; THAP domain-containing protein 0; THAP domain-containing protein 12; THAP0.

Gene ID

5612

Accession Number

NP_004696.2

Reactivity

Homo sapiens|Human

Target

Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR) . May block the PKR-inhibitory function of DNAJC3, resulting in restoration of kinase activity and suppression of cell growth.

Type

Protein

Source

E.coli

Sequence

MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.