Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKRIR Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

THAP domain containing 12

Gene Aliases

52 kDa repressor of the inhibitor of the protein kinase;58 kDa interferon-induced protein kinase-interacting protein; DAP4; death-associated protein 4; inhibitor of protein kinase PKR; P52rIPK; p58IPK-interacting protein; P58IPK-regulatory protein; PRKRIR; protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) ; testicular tissue protein Li 133; THAP domain-containing protein 0; THAP domain-containing protein 12; THAP0.

Gene ID

5612

Accession Number

NP_004696.2

Reactivity

Homo sapiens|Human

Target

Upstream regulator of interferon-induced serine/threonine protein kinase R (PKR) . May block the PKR-inhibitory function of DNAJC3, resulting in restoration of kinase activity and suppression of cell growth.

Type

Protein

Source

E.coli

Sequence

MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

THAP12

Host or Source

Human

Protein Name

52 kDa repressor of the inhibitor of the protein kinase

Gene Name URL

THAP12

Nucleotide Accession Number

NM_004705.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myom1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
31310116 3x 1.0 µg

Myom1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
RAB23 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
38311156 3x 1.0 µg DNA

RAB23 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)
MBS1331716-01 0.02 mg (E-Coli)

Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)

Sign In for Pricing
View Details
Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)
MBS1331716-02 0.02 mg (Yeast)

Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)

Sign In for Pricing
View Details
Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)
MBS1331716-03 0.1 mg (E-Coli)

Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)

Sign In for Pricing
View Details
Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)
MBS1331716-04 0.1 mg (Yeast)

Recombinant Mouse UPF0160 protein MYG1, mitochondrial (Myg1)

Sign In for Pricing
View Details