Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPM1B Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Protein phosphatase, Mg2+/Mn2+ dependent 1B

Gene Aliases

PP2CB; PP2C-beta; PP2CBETA; PP2C-beta-X; PPC2BETAX; protein phosphatase 1B; Protein phosphatase 2C isoform beta; protein phosphatase 2C-like protein.

Gene ID

5495

Accession Number

NP_001028729.1

Reactivity

Homo sapiens|Human

Target

Enzyme with a broad specificity. Dephosphorylates CDK2 and CDK6 in vitro. Dephosphorylates PRKAA1 and PRKAA2. Inhibits TBK1-mediated antiviral signaling by dephosphorylating it at 'Ser-172'. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.

Type

Protein

Source

E.coli

Sequence

SIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PPM1B

Host or Source

Human

Protein Name

Protein phosphatase 1B

Gene Name URL

PPM1B

Nucleotide Accession Number

NM_001033557.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB20 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50691065 1.0 µg DNA

ZBTB20 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915961-01 48 Well

Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915961-02 96 Well

Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915961-03 5x 96 Well

Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit
MBS9915961-04 10x 96 Well

Horse Transducin Beta-Like Protein 2 (TBL2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Complement fragment 5a ELISA kit
GTR10429303 96 Well

Rabbit Complement fragment 5a ELISA kit

Sign In for Pricing
View Details