Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR3A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

RNA polymerase III subunit A

Gene Aliases

ADDH; C160; DNA-directed RNA polymerase III largest subunit; DNA-directed RNA polymerase III subunit A; DNA-directed RNA polymerase III subunit RPC1; HLD7; hRPC155; polymerase (RNA) III (DNA directed) polypeptide A, 155kDa; polymerase (RNA) III subunit A; RNA polymerase III 155 kDa subunit; RNA polymerase III subunit C1; RNA polymerase III subunit C160; RNA polymerase III subunit RPC155-D; RPC1; RPC155; WDRTS.

Gene ID

11128

Accession Number

NP_008986.2

Reactivity

Homo sapiens|Human

Target

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic core component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Forms the polymerase active center together with the second largest subunit. A single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol III. A bridging helix emanates from RPC1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol III by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition (By similarity) . Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs) induce type I interferon and NF- Kappa-B through the RIG-I pathway.

Type

Protein

Source

E.coli

Sequence

FPEKVNKANINFLRKLVQNGPEVHPGANFIQQRHTQMKRFLKYGNREKMAQELKYGDIVERHLIDGDVVLFNRQPSLHKLSIMAHLARVKPHRTFRFNECVCTPYNADFDGDEMNLHLPQTEEAKAEALVLMGTKANLVTPRNGEPLIAAIQDFLTGAYLLTLKDTFFDRAKACQIIASILVGKDEKIKVRLPPPTILKPVTLWTGKQIFSVILRPSDDNPVRANLRTKGKQYCGKGEDLC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

POLR3A

Host or Source

Human

Protein Name

DNA-directed RNA polymerase III subunit RPC1

Gene Name URL

POLR3A

Nucleotide Accession Number

NM_007055.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Oncostatin M Receptor (OSMR) ELISA Kit
orb1664317-01 48 Tests

Human Oncostatin M Receptor (OSMR) ELISA Kit

Sign In for Pricing
View Details
Human Oncostatin M Receptor (OSMR) ELISA Kit
orb1664317-02 96 Tests

Human Oncostatin M Receptor (OSMR) ELISA Kit

Sign In for Pricing
View Details
TRH, Free Acid
MBS826389-01 1 mg

TRH, Free Acid

Sign In for Pricing
View Details
TRH, Free Acid
MBS826389-02 5 mg

TRH, Free Acid

Sign In for Pricing
View Details
TRH, Free Acid
MBS826389-03 10 mg

TRH, Free Acid

Sign In for Pricing
View Details
TRH, Free Acid
MBS826389-04 5x 10 mg

TRH, Free Acid

Sign In for Pricing
View Details