What is the catalog number for Plp Recombinant Protein?

The catalog number for Plp Recombinant Protein is OPCA01789-100UG.

What sizes are available for Plp Recombinant Protein?

Plp Recombinant Protein is available in the following size(s): 100 µg.

Is Plp Recombinant Protein in stock?

Plp Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

What do I do if this product arrives with reduced ice or a damaged cold-chain package?

Report this to us immediately with photos and your order reference. Our specialists will assess whether the product is still usable given the cold-chain interruption, and will arrange a replacement or credit if it isn’t.

What host species was used to raise this antibody?

The host species used in production is listed under product specifications on the datasheet, and is relevant when selecting a compatible secondary antibody for your assay.

Plp Recombinant Protein

Selected Variant

OPCA01789-100UG

Size: 100 µg

Product Specifications

CAS Number

9000-83-3

Gene Name

Myelin proteolipid protein

Gene Aliases

DM20; lipophilin; myelin proteolipid protein.

Gene ID

100136749

Accession Number

NP_001118173.1

Reactivity

Oncorhynchus mykiss|Rainbow Trout

Target

This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.

Type

Protein

Source

E.coli

Sequence

PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Plp

Host or Source

Oncorhynchus mykiss

Protein Name

Myelin proteolipid protein

Gene Name URL

Plp

Nucleotide Accession Number

NM_001124701.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Kallikrein 11/KLK11 Antibody Picoband® (Biotine Conjugate)

PA1631-Biotin 100 µg/Vial