Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plp Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Myelin proteolipid protein

Gene Aliases

DM20; lipophilin; myelin proteolipid protein.

Gene ID

100136749

Accession Number

NP_001118173.1

Reactivity

Oncorhynchus mykiss|Rainbow Trout

Target

This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.

Type

Protein

Source

E.coli

Sequence

PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

11.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Plp

Host or Source

Oncorhynchus mykiss

Protein Name

Myelin proteolipid protein

Gene Name URL

Plp

Nucleotide Accession Number

NM_001124701.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM47 Antibody
A48505-100UL 100 µL

TRIM47 Antibody

Sign In for Pricing
View Details
SARM1 (Sterile alpha and TIR motif containing 1) (MaxLight 550) discontinued
S0097-70B-ML550 100 µL

SARM1 (Sterile alpha and TIR motif containing 1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Absolute Mag™ Carboxyl Magnetic Poly (lactic acid) Particles, 30 µm
WHM-G171 10 mL

Absolute Mag™ Carboxyl Magnetic Poly (lactic acid) Particles, 30 µm

Sign In for Pricing
View Details
ZNF529 Blocking Peptide
33R-7654 0.1 mg

ZNF529 Blocking Peptide

Sign In for Pricing
View Details
V-ATPase H shRNA (h) Lentiviral Particles
sc-36801-V 200 µL

V-ATPase H shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
FNDC11 Antibody - C-terminal region : Biotin (ARP53764_P050-Biotin)
ARP53764_P050-Biotin 100 µL

FNDC11 Antibody - C-terminal region : Biotin (ARP53764_P050-Biotin)

Sign In for Pricing
View Details