Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Def Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Polypeptide deformylase.

Gene ID

947780

Accession Number

NP_417745.1

Reactivity

Escherichia coli

Target

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity) .

Type

Protein

Source

E.coli

Sequence

SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DEF

Host or Source

Escherichia coli

Protein Name

Peptide deformylase

Gene Name URL

DEF

Nucleotide Accession Number

NC_000913.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcyclin, CT (Protein S100-A6, S100 Calcium-binding Protein A6, S100A6, Prolactin Receptor-associated Protein, PRA, Growth Factor-inducible Protein 2A9, MLN 4, CACY) (MaxLight 750)
MBS6466688-01 0.1 mL

Calcyclin, CT (Protein S100-A6, S100 Calcium-binding Protein A6, S100A6, Prolactin Receptor-associated Protein, PRA, Growth Factor-inducible Protein 2A9, MLN 4, CACY) (MaxLight 750)

Sign In for Pricing
View Details
Calcyclin, CT (Protein S100-A6, S100 Calcium-binding Protein A6, S100A6, Prolactin Receptor-associated Protein, PRA, Growth Factor-inducible Protein 2A9, MLN 4, CACY) (MaxLight 750)
MBS6466688-02 5x 0.1 mL

Calcyclin, CT (Protein S100-A6, S100 Calcium-binding Protein A6, S100A6, Prolactin Receptor-associated Protein, PRA, Growth Factor-inducible Protein 2A9, MLN 4, CACY) (MaxLight 750)

Sign In for Pricing
View Details
Rabbit Polyclonal ZDHHC16 Antibody
NBP2-55212 100 µL

Rabbit Polyclonal ZDHHC16 Antibody

Sign In for Pricing
View Details
Lentiviral human SH2D2A sgRNA gene knockout kit - Lentiviral human SH2D2A sgRNA gene knockout kit (100)
GTR15389224 1 Vial

Lentiviral human SH2D2A sgRNA gene knockout kit - Lentiviral human SH2D2A sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Rabbit Polyclonal Cytochrome P450 4F11 Antibody
NBP1-69423 100 µL

Rabbit Polyclonal Cytochrome P450 4F11 Antibody

Sign In for Pricing
View Details
Socs7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3123506 1.0 µg DNA

Socs7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details