Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTX2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Orthodenticle homeobox 2

Gene Aliases

CPHD6; homeobox protein OTX2; MCOPS5; orthodenticle homolog 2.

Gene ID

5015

Accession Number

NP_001257452.1

Reactivity

Homo sapiens|Human

Target

Transcription factor probably involved in the development of the brain and the sense organs. Can bind to the bicoid/BCD target sequence (BTS) : 5'-TCTAATCCC-3'.

Type

Protein

Source

E.coli

Sequence

MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPGPWASCPAATPRKQRRERTTFTRAQLDVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

OTX2

Host or Source

Human

Protein Name

Homeobox protein OTX2

Gene Name URL

OTX2

Nucleotide Accession Number

NM_001270523.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8P35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV730544 1.0 µg DNA

KRT8P35 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial
MBS9020827-01 0.02 mg (E-Coli)

Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial

Sign In for Pricing
View Details
Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial
MBS9020827-02 0.1 mg (E-Coli)

Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial

Sign In for Pricing
View Details
Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial
MBS9020827-03 1 mg (E-Coli)

Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial

Sign In for Pricing
View Details
Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial
MBS9020827-04 5x 1 mg (E-Coli)

Recombinant Human Zinc finger and BTB domain-containing protein 32 (ZBTB32), partial

Sign In for Pricing
View Details
MSMB (Microseminoprotein Beta, MSP, PSP, Immunoglobulin-binding Factor, IGBF, MSPB, PN44, PRPS, HPC13, PSP57, PSP94, PSP-94) discontinued
212096-01 20 µL

MSMB (Microseminoprotein Beta, MSP, PSP, Immunoglobulin-binding Factor, IGBF, MSPB, PN44, PRPS, HPC13, PSP57, PSP94, PSP-94) discontinued

Sign In for Pricing
View Details