What is the catalog number for NRG2 Recombinant Protein?

The catalog number for NRG2 Recombinant Protein is OPCA01761-100UG.

What sizes are available for NRG2 Recombinant Protein?

NRG2 Recombinant Protein is available in the following size(s): 100 µg.

Is NRG2 Recombinant Protein in stock?

NRG2 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product animal-origin-free?

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

NRG2 Recombinant Protein

Selected Variant

OPCA01761-100UG

Size: 100 µg

Product Specifications

CAS Number

9000-83-3

Gene Name

Neuregulin 2

Gene Aliases

Divergent of neuregulin-1; DON1; HRG2; neural- and thymus-derived activator for ErbB kinases; NTAK; pro-neuregulin-2, membrane-bound isoform; pro-NRG2.

Gene ID

9542

Accession Number

NP_001171864.1

Reactivity

Homo sapiens|Human

Target

Direct ligand for ERBB3 and ERBB4 tyrosine kinase receptors. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. May also promote the heterodimerization with the EGF receptor.

Type

Protein

Source

E.coli

Sequence

CYSPSLKSVQDQAYKAPVVVEGKVQGLVPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMKSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVKVEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYIEGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NRG2

Host or Source

Human

Protein Name

Pro-neuregulin-2, membrane-bound isoform

Gene Name URL

NRG2

Nucleotide Accession Number

NM_001184935.1

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNUB0096-500 1x 500 µL