Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOL3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Nucleolar protein 3

Gene Aliases

Apoptosis repressor with CARD; ARC; FCM; muscle-enriched cytoplasmic protein; MYOCL1; MYP; NOP; NOP30; nucleolar protein 3; nucleolar protein 3 (apoptosis repressor with CARD domain) ; nucleolar protein of 30 kDa.

Gene ID

8996

Accession Number

NP_001171986.1

Reactivity

Homo sapiens|Human

Target

Isoform 1: May be involved in RNA splicing.

Type

Protein

Source

E.coli

Sequence

MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NOL3

Host or Source

Human

Protein Name

Nucleolar protein 3

Gene Name URL

NOL3

Nucleotide Accession Number

NM_001185057.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Metabotropic glutamate receptor 6 (GRM6) ELISA kit
GTR10401180 96 Well

Canine Metabotropic glutamate receptor 6 (GRM6) ELISA kit

Sign In for Pricing
View Details
MRPL46 (NM_022163) Human Tagged Lenti ORF Clone
RC204786L3 10 µg

MRPL46 (NM_022163) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (AP)
MBS6456943-01 0.2 mL

LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (AP)

Sign In for Pricing
View Details
LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (AP)
MBS6456943-02 5x 0.2 mL

LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (AP)

Sign In for Pricing
View Details
DPH2 (DPH2 Homolog (S. cerevisiae), DPH2L2) (PE)
MBS6186718-01 0.1 mL

DPH2 (DPH2 Homolog (S. cerevisiae), DPH2L2) (PE)

Sign In for Pricing
View Details
DPH2 (DPH2 Homolog (S. cerevisiae), DPH2L2) (PE)
MBS6186718-02 5x 0.1 mL

DPH2 (DPH2 Homolog (S. cerevisiae), DPH2L2) (PE)

Sign In for Pricing
View Details