What is the catalog number for NKTR Recombinant Protein?

The catalog number for NKTR Recombinant Protein is OPCA01753-100UG.

What sizes are available for NKTR Recombinant Protein?

NKTR Recombinant Protein is available in the following size(s): 100 µg.

Is NKTR Recombinant Protein in stock?

NKTR Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

NKTR Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Natural killer cell triggering receptor

Gene Aliases

Natural killer triggering receptor; natural killer-tumor recognition sequence; natural-killer cells cyclophilin-related protein; NK-TR protein; NK-tumor recognition protein; p104; peptidyl-prolyl cis-trans isomerase NKTR; PPIase; rotamase.

Gene ID

4820

Accession Number

NP_005376.2

Reactivity

Homo sapiens|Human

Target

PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding (PubMed:20676357) . Component of a putative tumor-recognition complex involved in the function of NK cells (PubMed:8421688) .

Type

Protein

Source

E.coli

Sequence

HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.