Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NKTR Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Natural killer cell triggering receptor

Gene Aliases

Natural killer triggering receptor; natural killer-tumor recognition sequence; natural-killer cells cyclophilin-related protein; NK-TR protein; NK-tumor recognition protein; p104; peptidyl-prolyl cis-trans isomerase NKTR; PPIase; rotamase.

Gene ID

4820

Accession Number

NP_005376.2

Reactivity

Homo sapiens|Human

Target

PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding (PubMed:20676357) . Component of a putative tumor-recognition complex involved in the function of NK cells (PubMed:8421688) .

Type

Protein

Source

E.coli

Sequence

HFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NKTR

Host or Source

Human

Protein Name

NK-tumor recognition protein

Gene Name URL

NKTR

Nucleotide Accession Number

NM_005385.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MBD1 Antibody
NB100-56330SS 0.025 mg

Rabbit Polyclonal MBD1 Antibody

Sign In for Pricing
View Details
1700008P02Rik 3'UTR Luciferase Stable Cell Line
TU100140 1.0 mL

1700008P02Rik 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Olr1075-set siRNA/shRNA/RNAi Lentivector (Rat)
33652096 4x 500 ng

Olr1075-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
Bovine ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) ELISA Kit
OM618656 96 Strip Well

Bovine ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) ELISA Kit

Sign In for Pricing
View Details
RBP4 (Plasma Retinol Binding Protein 4, Plasma Retinol-binding Protein, Plasma Retinol-binding Protein (1-176), PRBP, RBP, RDCCAS, RET4_HUMAN, Retinol Binding Protein 4, Retinol Binding Protein 4 Interstitial, Retinol Binding Protein 4 Plasma)
303574 100 µg

RBP4 (Plasma Retinol Binding Protein 4, Plasma Retinol-binding Protein, Plasma Retinol-binding Protein (1-176), PRBP, RBP, RDCCAS, RET4_HUMAN, Retinol Binding Protein 4, Retinol Binding Protein 4 Interstitial, Retinol Binding Protein 4 Plasma)

Sign In for Pricing
View Details
Recombinant HumanS100 Calcium Binding Protein Z, His Tag
7-06314 25 µg

Recombinant HumanS100 Calcium Binding Protein Z, His Tag

Sign In for Pricing
View Details