Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

NADH:ubiquinone oxidoreductase subunit B5

Gene Aliases

CISGDH; complex I SGDH subunit; complex I-SGDH; NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial; NADH-ubiquinone oxidoreductase SGDH subunit; SGDH.

Gene ID

4711

Accession Number

NP_001186886.1

Reactivity

Homo sapiens|Human

Target

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Type

Protein

Source

E.coli

Sequence

GQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NDUFB5

Host or Source

Human

Protein Name

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial

Gene Name URL

NDUFB5

Nucleotide Accession Number

NM_001199957.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Synaptotagmin V Lentiviral Activation Particles (h)
sc-408775-LAC 200 µL

Synaptotagmin V Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Lentiviral human RAD51 shRNA (UAS) - Lentiviral human RAD51 shRNA (UAS, GFP) (100)
GTR15154785 1 Vial

Lentiviral human RAD51 shRNA (UAS) - Lentiviral human RAD51 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Epithelial membrane protein 3 (EMP3) Bovine ELISA Kit
D2215 96 Tests

Epithelial membrane protein 3 (EMP3) Bovine ELISA Kit

Sign In for Pricing
View Details
QSER1 Blocking Peptide
abx064274-01 1 mg

QSER1 Blocking Peptide

Sign In for Pricing
View Details
QSER1 Blocking Peptide
abx064274-02 5 mg

QSER1 Blocking Peptide

Sign In for Pricing
View Details
Tuberin (Phospho-Ser981) Polyclonal Conjugated Antibody
orb1630071 100 µL

Tuberin (Phospho-Ser981) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details