Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA6 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

NADH:ubiquinone oxidoreductase subunit A6

Gene Aliases

B14; CI-B14; Complex I-B14; LYR motif-containing protein 6; LYRM6; MC1DN33; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6; NADHB14; NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 6; NADH-ubiquinone oxidoreductase B14 subunit.

Gene ID

4700

Accession Number

NP_002481.2

Reactivity

Homo sapiens|Human

Target

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Type

Protein

Source

E.coli

Sequence

MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NDUFA6

Host or Source

Human

Protein Name

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

Gene Name URL

NDUFA6

Nucleotide Accession Number

NM_002490.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Borrelia burgdorferi (p41 Flagellin) (6802), CF640R conjugate, 0.1mg/mL
BNC400144-500 1x 500 µL

Borrelia burgdorferi (p41 Flagellin) (6802), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant TAF15 Antibody
RC-6941-01 50 μL

Recombinant TAF15 Antibody

Sign In for Pricing
View Details
Recombinant TAF15 Antibody
RC-6941-02 100 µL

Recombinant TAF15 Antibody

Sign In for Pricing
View Details
Recombinant TAF15 Antibody
RC-6941-03 1 mL

Recombinant TAF15 Antibody

Sign In for Pricing
View Details
WNT8A (NM_058244) Human Recombinant Protein
TP324816L 1 mg

WNT8A (NM_058244) Human Recombinant Protein

Sign In for Pricing
View Details
GDC-0879 Hydrochloride
TRC-G299980-25MG 25 mg

GDC-0879 Hydrochloride

Sign In for Pricing
View Details