Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOS2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Nanos C2HC-type zinc finger 2

Gene Aliases

Nanos homolog 2; NOS2; NOS-2; ZC2HC12B.

Gene ID

339345

Accession Number

NP_001025032.1

Reactivity

Homo sapiens|Human

Target

Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state (By similarity) .

Type

Protein

Source

E.coli

Sequence

MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

31.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NANOS2

Host or Source

Human

Protein Name

Nanos homolog 2

Gene Name URL

NANOS2

Nucleotide Accession Number

NM_001029861.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nkx-2.5 (A-3) AC
sc-376565 AC 500 µg/mL - 25% ag

Nkx-2.5 (A-3) AC

Sign In for Pricing
View Details
ETS1 Rabbit Polyclonal Antibody
orb2951960-01 50 µg

ETS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ETS1 Rabbit Polyclonal Antibody
orb2951960-02 100 µg

ETS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Albumin (Numab patent HSA) discontinued
048344 100 µg

Albumin (Numab patent HSA) discontinued

Sign In for Pricing
View Details
Rabbit HBS1L Antibody
orb1521225-01 10 µL

Rabbit HBS1L Antibody

Sign In for Pricing
View Details
Rabbit HBS1L Antibody
orb1521225-02 100 µL

Rabbit HBS1L Antibody

Sign In for Pricing
View Details