Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYEF2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Myelin expression factor 2

Gene Aliases

HsT18564; MEF-2; MST156; MSTP156; myEF-2; myelin expression factor 2; myelin gene expression factor 2.

Gene ID

50804

Accession Number

NP_001288139.1

Reactivity

Homo sapiens|Human

Target

Transcriptional repressor of the myelin basic protein gene (MBP) . Binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA (By similarity) .

Type

Protein

Source

E.coli

Sequence

GGMNRIGGGIGFGGLEAMNSMGGFGGVGRMGELYRGAMTSSMERDFGRGDIGINQGFGDSFGRLGSAMIGGFAGRIGSSNMGPVGSGISGGMGSMNSVTGGMGMGLDRMSSSFDRMGPGIGAILERSIDMDRGFLSGPMGSGMRERIGSKGNQIFVRNLPFDLTWQKLKEKFSQCGHVMFAEIKMENGKSKGCGTVRFDSPESAE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MYEF2

Host or Source

Human

Protein Name

Myelin expression factor 2

Gene Name URL

MYEF2

Nucleotide Accession Number

NM_001301210.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASCC3 Protein Vector (Human) (pPM-N-D-C-HA)
PV324268 500 ng

ASCC3 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Tdgf1 3'UTR Luciferase Stable Cell Line
TU120323 1.0 mL

Tdgf1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant human NDUFA2 protein
ATGP1770-050 50 µg

Recombinant human NDUFA2 protein

Sign In for Pricing
View Details
GIPR (Gastric Inhibitory Polypeptide Receptor, GIP-R, Glucose-dependent Insulinotropic Polypeptide Receptor, GIPR)
406504-01 50 µL

GIPR (Gastric Inhibitory Polypeptide Receptor, GIP-R, Glucose-dependent Insulinotropic Polypeptide Receptor, GIPR)

Sign In for Pricing
View Details
GIPR (Gastric Inhibitory Polypeptide Receptor, GIP-R, Glucose-dependent Insulinotropic Polypeptide Receptor, GIPR)
406504-02 100 µL

GIPR (Gastric Inhibitory Polypeptide Receptor, GIP-R, Glucose-dependent Insulinotropic Polypeptide Receptor, GIPR)

Sign In for Pricing
View Details
Triticum vulgare Gel -WGA- Immobilized Lectin
A-2101-2 2 mL

Triticum vulgare Gel -WGA- Immobilized Lectin

Sign In for Pricing
View Details