Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK13 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Mitogen-activated protein kinase 13

Gene Aliases

MAP kinase 13; MAP kinase p38 delta; MAPK 13; MAPK-13; mitogen-activated protein kinase 13; mitogen-activated protein kinase p38 delta; p38delta; PRKM13; SAPK4; stress-activated protein kinase 4.

Gene ID

5603

Accession Number

NP_002745.1

Reactivity

Homo sapiens|Human

Target

Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK13 is one of the four p38 MAPKs which play an important role in the cascades of cellular responses evoked by extracellular stimuli such as proinflammatory cytokines or physical stress leading to direct activation of transcription factors such as ELK1 and ATF2. Accordingly, p38 MAPKs phosphorylate a broad range of proteins and it has been estimated that they may have approximately 200 to 300 substrates each. MAPK13 is one of the less studied p38 MAPK isoforms. Some of the targets are downstream kinases such as MAPKAPK2, which are activated through phosphorylation and further phosphorylate additional targets. Plays a role in the regulation of protein translation by phosphorylating and inactivating EEF2K. Involved in cytoskeletal remodeling through phosphorylation of MAPT and STMN1. Mediates UV irradiation induced up-regulation of the gene expression of CXCL14. Plays an important role in the regulation of epidermal keratinocyte differentiation, apoptosis and skin tumor development. Phosphorylates the transcriptional activator MYB in response to stress which leads to rapid MYB degradation via a proteasome-dependent pathway. MAPK13 also phosphorylates and down-regulates PRKD1 during regulation of insulin secretion in pancreatic beta cells.

Type

Protein

Source

E.coli

Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MAPK13

Host or Source

Human

Protein Name

Mitogen-activated protein kinase 13

Gene Name URL

MAPK13

Nucleotide Accession Number

NM_002754.4

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal CNPY1 Antibody
NBP2-82720-0.1mL 0.1 mL

Rabbit Polyclonal CNPY1 Antibody

Ask
View Details
CLACP (COL25A1) (NM_032518) Human Tagged ORF Clone Lentiviral Particle
RC222555L4V 200 µL

CLACP (COL25A1) (NM_032518) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
PLV3-U6-PARP1-shRNA2-Puro Plasmid
PVT79625 2 µg

PLV3-U6-PARP1-shRNA2-Puro Plasmid

Ask
View Details
Golgin 84 shRNA (m) Lentiviral Particles
sc-145670-V 200 µL

Golgin 84 shRNA (m) Lentiviral Particles

Ask
View Details
Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Protein
abx655572-01 100 µg

Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Protein

Ask
View Details
Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Protein
abx655572-02 200 µg

Human Carcinoembryonic Antigen-Related Cell Adhesion Molecule 5 (CEACAM5) Protein

Ask
View Details