Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRP4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

LDL receptor related protein 4

Gene Aliases

CLSS; CMS17; low-density lipoprotein receptor-related protein 4; LRP10; LRP-4; MEGF7; multiple epidermal growth factor-like domains 7; SOST2.

Gene ID

4038

Accession Number

NP_002325.2

Reactivity

Homo sapiens|Human

Target

Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing extracellular ligands for degradation by lysosomes. May play an essential role in the process of digit differentiation (By similarity) .

Type

Protein

Source

E.coli

Sequence

YRHKKSKFTDPGMGNLTYSNPSYRTSTQEVKIEAIPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQSECSSVHTAATPERRGSLPDTGWKHERKLSSESQV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LRP4

Host or Source

Human

Protein Name

Low-density lipoprotein receptor-related protein 4

Gene Name URL

LRP4

Nucleotide Accession Number

NM_002334.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), 0.2mg/mL
BNUB0352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), 0.2mg/mL

Sign In for Pricing
View Details
GSTM3 (NM_000849) Human Over-expression Lysate
LC424491 20 µg

GSTM3 (NM_000849) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant DNPH1 Antibody
RC-16508-01 50 μL

Recombinant DNPH1 Antibody

Sign In for Pricing
View Details
Recombinant DNPH1 Antibody
RC-16508-02 100 µL

Recombinant DNPH1 Antibody

Sign In for Pricing
View Details
Recombinant DNPH1 Antibody
RC-16508-03 1 mL

Recombinant DNPH1 Antibody

Sign In for Pricing
View Details
Slc26a5 Mouse Gene Knockout Kit (CRISPR)
KN516007 1 Kit

Slc26a5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details