What is the catalog number for LRBA Recombinant Protein?

The catalog number for LRBA Recombinant Protein is OPCA01702-100UG.

What sizes are available for LRBA Recombinant Protein?

LRBA Recombinant Protein is available in the following size(s): 100 µg.

Is LRBA Recombinant Protein in stock?

LRBA Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

What is the difference between this product and a similar catalogue number?

Differences typically involve clone, conjugate, host species, or validated applications. Compare the respective datasheets, or contact us with both catalogue numbers for a direct comparison.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

LRBA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

LPS responsive beige-like anchor protein

Gene Aliases

Beige-like protein; BGL; CDC4L; CDC4-like protein; CVID8; LAB300; LBA; lipopolysaccharide-responsive and beige-like anchor protein; LPS-responsive vesicle trafficking, beach and anchor containing; vesicle trafficking, beach and anchor containing.

Gene ID

987

Accession Number

NP_001186211.2

Reactivity

Homo sapiens|Human

Target

May be involved in coupling signal transduction and vesicle trafficking to enable polarized secretion and/or membrane deposition of immune effector molecules.

Type

Protein

Source

E.coli

Sequence

PQPHRHVLEISRQHEQPGQGIAPDAVNGQRRDSRSTVFRIPEFNWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKSMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKTRGDKALKPMHSLIPLGKSAAKSPVDIVTGGISPV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LRBA

Host or Source

Human

Protein Name

Lipopolysaccharide-responsive and beige-like anchor protein

Gene Name URL

LRBA

Nucleotide Accession Number

NM_001199282.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNC940032-100 1x 100 µL