Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kif1a Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Axonal transporter of synaptic vesicles.

Reactivity

Mouse|Mus musculus

Target

Motor for anterograde axonal transport of synaptic vesicle precursors.

Type

Protein

Source

E.coli

Sequence

MAGASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKTDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRCNAIIN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

56.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

KIF1A

Host or Source

Mouse

Protein Name

Kinesin-like protein KIF1A

Gene Name URL

KIF1A

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Human Peptidase D (PEPD) ELISA
KBH6518 96 Well

GENLISA™ Human Peptidase D (PEPD) ELISA

Sign In for Pricing
View Details
Cd160 sgRNA CRISPR Lentivector set (Mouse)
K3680401 3x 1.0 µg

Cd160 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Olr1159 AAV Vector (Rat) (CMV)
33713106 1 µg

Olr1159 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
CK20 Recombinant Rabbit mAb, BF594 conjugated
orb2355680 100 µL

CK20 Recombinant Rabbit mAb, BF594 conjugated

Sign In for Pricing
View Details
Natriuretic Peptide Receptor B Rabbit pAb
E47R2348 100 µL

Natriuretic Peptide Receptor B Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal MLH1 Antibody (MLH1/6467) [Alexa Fluor 750]
NBP3-14122AF750 0.1 mL

Mouse Monoclonal MLH1 Antibody (MLH1/6467) [Alexa Fluor 750]

Sign In for Pricing
View Details