Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Kcne2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Potassium voltage-gated channel subfamily E regulatory subunit 2

Gene Aliases

Minimum potassium ion channel-related peptide 1; minK-related peptide 1; Mirp1; potassium channel subunit beta MiRP1; potassium channel, voltage gated subfamily E regulatory beta subunit 2; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 2; potassium voltage-gated channel subfamily E member 2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel, Isk-related subfamily, gene 2.

Gene ID

171138

Accession Number

NP_598287.1

Reactivity

Rat|Rattus norvegicus

Target

Ancillary protein that assembles as a beta subunit with a voltage-gated potassium channel complex of pore-forming alpha subunits. Modulates the gating kinetics and enhances stability of the channel complex. Assembled with KCNB1 modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 (PubMed:19219384) . Associated with KCNH2/HERG is proposed to form the rapidly activating component of the delayed rectifying potassium current in heart (IKr) . May associate with KCNQ2 and/or KCNQ3 and modulate the native M-type current. May associate with HCN1 and HCN2 and increase potassium current (By similarity) . Interacts with KCNQ1; forms a heterooligomer complex leading to currents with an apparently instantaneous activation, a rapid deactivation process and a linear current-voltage relationship and decreases the amplitude of the outward current (By similarity) .

Type

Protein

Source

E.coli

Sequence

MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

18.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Kcne2

Host or Source

Rat

Protein Name

Potassium voltage-gated channel subfamily E member 2

Gene Name URL

Kcne2

Nucleotide Accession Number

NM_133603.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDH Antibody
MBS7122577-01 0.05 mg

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
MBS7122577-02 0.1 mg

GAPDH Antibody

Sign In for Pricing
View Details
GAPDH Antibody
MBS7122577-03 5x 0.1 mg

GAPDH Antibody

Sign In for Pricing
View Details
8- Hexylaminoadenosine- 3', 5'- cyclic monophosphate, sodium salt (8-HA-cAMP)
H 006-25 5x 5 µmol

8- Hexylaminoadenosine- 3', 5'- cyclic monophosphate, sodium salt (8-HA-cAMP)

Sign In for Pricing
View Details
Mouse Monoclonal Bestrophin 3 Antibody (OTI2H3) [mFluor Violet 450 SE]
NBP2-72407MFV450 0.1 mL

Mouse Monoclonal Bestrophin 3 Antibody (OTI2H3) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit anti-Biotin Recombinant Monoclonal Antibody [BLR315M)
A700-315-T 10 µL (5+ Tests)

Rabbit anti-Biotin Recombinant Monoclonal Antibody [BLR315M)

Sign In for Pricing
View Details