Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITPKB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Inositol-trisphosphate 3-kinase B

Gene Aliases

Inositol 1,4,5-trisphosphate 3-kinase B; inositol-trisphosphate 3-kinase B; insP 3-kinase B; IP3 3-kinase B; IP3-3KB; IP3K; IP3K B; IP3KB; IP3K-B; PIG37; proliferation-inducing protein 37.

Gene ID

3707

Accession Number

NP_002212.3

Reactivity

Homo sapiens|Human

Target

The protein encoded by this protein regulates inositol phosphate metabolism by phosphorylation of second messenger inositol 1,4,5-trisphosphate to Ins (1,3,4,5) P4. The activity of this encoded protein is responsible for regulating the levels of a large number of inositol polyphosphates that are important in cellular signaling. Both calcium/calmodulin and protein phosphorylation mechanisms control its activity.

Type

Protein

Source

E.coli

Sequence

RVEGGSPTLGLLGGSPSAQPGTGNVEAGIPSGRMLEPLPCWDAAKDLKEPQCPPGDRVGVQPGNSRVWQGTMEKAGLAWTRGTGVQSEGTWESQRQDSDALPSPELLPQDPDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPRVSKSWRKIKNMVHWSPFVMSFKKKYPWIQLAGHAGSFKAAANGRILKKHCESEQRCLDRLMVDVLRPFVPAYHGDVVKDGERYNQMDDLLADFDSPCVMDCKMGIRTYLEEELTKARKKPSLRKDMYQKMIEVDPEAPTEEEKAQRAVTKPRYMQWRETISSTATLGFRIEGIKKEDGTVNRDFKKTKTREQVTEAFREFTKGNHNILIAYRDRLKAIRTTLEVSPFFKCHEVIGSSLLFIHDKKEQAKVWMIDFGKTTPLPEGQTLQHDVPWQEGNREDGYLSGLNNLVDILTEMSQDAPLA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

72.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ITPKB

Host or Source

Human

Protein Name

Inositol-trisphosphate 3-kinase B

Gene Name URL

ITPKB

Nucleotide Accession Number

NM_002221.3

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNAI1 Antibody
orb572194 100 µL

SNAI1 Antibody

Sign In for Pricing
View Details
2- (4-ethylpiperazin-1-yl) isonicotinonitrile
sc-339902 1 g

2- (4-ethylpiperazin-1-yl) isonicotinonitrile

Sign In for Pricing
View Details
KD-Validated Anti-Thyroid hormone receptor interactor 10 Rabbit Monoclonal Antibody
AGI1468-100 100 µL

KD-Validated Anti-Thyroid hormone receptor interactor 10 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Claudin 12,CLDN12 ELISA KIT
JOT-EK0891Mo 96 wells

Mouse Claudin 12,CLDN12 ELISA KIT

Sign In for Pricing
View Details
hsa-let-7d miRNA Antagomir
MNH01010 2x 5.0 nmol

hsa-let-7d miRNA Antagomir

Sign In for Pricing
View Details
Pyrogallol Red
sc-215766 1 g

Pyrogallol Red

Sign In for Pricing
View Details