Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INMT Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Indolethylamine N-methyltransferase

Gene Aliases

Amine N-methyltransferase; aromatic alkylamine N-methyltransferase; arylamine N-methyltransferase; indolamine N-methyltransferase; indolethylamine N-methyltransferase; nicotine N-methyltransferase; TEMT; thioether S-methyltransferase.

Gene ID

11185

Accession Number

NP_001186148.1

Reactivity

Homo sapiens|Human

Target

Functions as thioether S-methyltransferase and is active with a variety of thioethers and the corresponding selenium and tellurium compounds, including 3-methylthiopropionaldehyde, dimethyl selenide, dimethyl telluride, 2-methylthioethylamine, 2-methylthioethanol, methyl-n-propyl sulfide and diethyl sulfide. Plays an important role in the detoxification of selenium compounds (By similarity) . Catalyzes the N-methylation of tryptamine and structurally related compounds.

Type

Protein

Source

E.coli

Sequence

MKGGFTGGDEYQKHFLPRDYLATYYSFDGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCFIVARKKPGP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

INMT

Host or Source

Human

Protein Name

Indolethylamine N-methyltransferase

Gene Name URL

INMT

Nucleotide Accession Number

NM_001199219.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hey1 ORF Vector (Rat) (pORF)
23227016 1.0 µg DNA

Hey1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Securin Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61676R-BF350-01 20 µL

Securin Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Securin Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61676R-BF350-02 100 µL

Securin Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)
MBS6502320-01 0.2 mL

TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)

Sign In for Pricing
View Details
TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)
MBS6502320-02 5x 0.2 mL

TERT, Phosphorylated (Tyr707) (Telomerase Reverse Transcriptase, Telomerase Catalytic Subunit, HEST2, Telomerase-associated Protein 2, TP2, EST2, TCS1, TRT) (Azide free) (HRP)

Sign In for Pricing
View Details
AGAP3 Protein Vector (Human) (pPM-C-HA)
11497021 500 ng

AGAP3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details