Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INHA Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Inhibin subunit alpha

Gene Aliases

Inhibin A; inhibin alpha chain; inhibin alpha subunit; inhibin, alpha.

Gene ID

281254

Accession Number

NP_776519.2

Reactivity

Bos taurus|Bovine

Target

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Type

Protein

Source

E.coli

Sequence

STPPLPWPWSPAALRLLQRPPEEPAAHADCHRAALNISFQELGWDRWIVHPPSFIFYYCHGGCGLSPPQDLPLPVPGVPPTPVQPLSLVPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYEMVPNLLTQHCACI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

INHA

Host or Source

Bovine

Protein Name

Inhibin alpha chain

Gene Name URL

INHA

Nucleotide Accession Number

NM_174094.4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hoxb8 sgRNA CRISPR Lentivector set (Rat)
K6763501 3x 1.0 µg

Hoxb8 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
L-Arginine, GlenCell™, suitable for cell culture
GM1092-250g 250 g

L-Arginine, GlenCell™, suitable for cell culture

Sign In for Pricing
View Details
Porcine Olfactory receptor 1E1 (OR1E1) ELISA Kit
GTR10352573 96 Well

Porcine Olfactory receptor 1E1 (OR1E1) ELISA Kit

Sign In for Pricing
View Details
USP21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2599108 1.0 µg DNA

USP21 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
X-376 5mg
A20971-5 5 mg

X-376 5mg

Sign In for Pricing
View Details
Tetrahydro-​2-​thiophenemethanol 1, ​1-​dioxide
KWC36085-01 50 mg

Tetrahydro-​2-​thiophenemethanol 1, ​1-​dioxide

Sign In for Pricing
View Details