Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL1A Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 1 alpha

Gene Aliases

Hematopoietin-1; IL-1 alpha; interleukin-1 alpha.

Gene ID

700193

Accession Number

NP_001036222.1

Reactivity

Macaca mulatta|Rhesus Monkey

Target

Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.

Type

Protein

Source

E.coli

Sequence

SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

34.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IL1A

Host or Source

Macaca mulatta

Protein Name

Interleukin-1 alpha

Gene Name URL

IL1A

Nucleotide Accession Number

NM_001042757.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFM2 (N-term) Rabbit pAb
E2615366 100 µL

IFM2 (N-term) Rabbit pAb

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)
MBS1308644-01 0.02 mg (E-Coli)

Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)
MBS1308644-02 0.02 mg (Yeast)

Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)
MBS1308644-03 0.1 mg (E-Coli)

Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)
MBS1308644-04 0.1 mg (Yeast)

Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)
MBS1308644-05 0.02 mg (Baculovirus)

Recombinant Drosophila melanogaster Probable tRNA (His) guanylyltransferase (l (2)35Bc)

Sign In for Pricing
View Details