Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IDH3G Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Isocitrate dehydrogenase (NAD (+) ) 3 non-catalytic subunit gamma

Gene Aliases

H-IDHG; IDH-gamma; isocitrate dehydrogenase (NAD (+) ) 3 gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; isocitrate dehydrogenase 3 (NAD (+) ) gamma; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase 3 gamma; isocitrate dehydrogenase, NAD (+) -specific, mitochondrial, gamma subunit; isocitric dehydrogenase subunit gamma; NAD (H) -specific isocitrate dehydrogenase gamma subunit; NAD (+) -specific ICDH subunit gamma; NAD+-specific ICDH.

Gene ID

3421

Accession Number

NP_004126.1

Reactivity

Homo sapiens|Human

Target

Regulatory subunit which plays a role in the allosteric regulation of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers.

Type

Protein

Source

E.coli

Sequence

FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

54.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IDH3G

Host or Source

Human

Protein Name

Isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial

Gene Name URL

IDH3G

Nucleotide Accession Number

NM_004135.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF488A conjugate, 0.1mg/mL
BNC882900-500 1x 500 µL

ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (ATRX/2900R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HEPACAM (C-term) Rabbit Polyclonal Antibody
AP52030PU-N 400 µL

HEPACAM (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-01 50 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-02 100 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]
E-AB-F1351C-03 2x 100 Tests

FITC Anti-Mouse/Rat Foxp3 Antibody[FJK-16s]

Sign In for Pricing
View Details
Mouse NODAL Protein, Tag Free
NOL-M5133-1mg 1 mg

Mouse NODAL Protein, Tag Free

Sign In for Pricing
View Details