Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ID2 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Inhibitor of DNA binding 2

Gene Aliases

BHLHb26; cell growth-inhibiting gene 8; class B basic helix-loop-helix protein 26; DNA-binding protein inhibitor ID2; DNA-binding protein inhibitor ID-2; GIG8; helix-loop-helix protein ID2; ID2A; ID2H; inhibitor of differentiation 2; Inhibitor of DNA binding 2; inhibitor of DNA binding 2, dominant negative helix-loop-helix protein; inhibitor of DNA binding 2, HLH protein.

Gene ID

3398

Accession Number

NP_002157.2

Reactivity

Homo sapiens|Human

Target

Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Restricts the CLOCK and ARNTL/BMAL1 localization to the cytoplasm. Plays a role in both the input and output pathways of the circadian clock: in the input component, is involved in modulating the magnitude of photic entrainment and in the output component, contributes to the regulation of a variety of liver clock-controlled genes involved in lipid metabolism.

Type

Protein

Source

E.coli

Sequence

MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

30.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ID2

Host or Source

Human

Protein Name

DNA-binding protein inhibitor ID-2

Gene Name URL

ID2

Nucleotide Accession Number

NM_002166.4

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTSL1 Rabbit Polyclonal Antibody (FITC)
orb2090337 100 µL

ADAMTSL1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
OOCA01424-25T - Human RLN2 Primer Pair 2
OOCA01424-25T 25 Tests

OOCA01424-25T - Human RLN2 Primer Pair 2

Sign In for Pricing
View Details
SSB Rabbit Polyclonal Antibody
E10G04468 100 µL

SSB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Onecut2 Mouse shRNA Plasmid (Locus ID 225631)
TL515534 1 Kit

Onecut2 Mouse shRNA Plasmid (Locus ID 225631)

Sign In for Pricing
View Details
DYNLL1P1 sgRNA CRISPR Lentivector (Human) (Target 2)
K0643903 1.0 µg DNA

DYNLL1P1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
EMX2 (Biotin)
561468-01 50 µg

EMX2 (Biotin)

Sign In for Pricing
View Details