Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSD11B1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Hydroxysteroid 11-beta dehydrogenase 1

Gene Aliases

11-beta-HSD1;11-beta-hydroxysteroid dehydrogenase 1;11-DH; corticosteroid 11-beta-dehydrogenase isozyme 1; CORTRD2; HDL; HSD11; HSD11B; HSD11L; SDR26C1; short chain dehydrogenase/reductase family 26C member 1.

Gene ID

3290

Accession Number

NP_001193670.1

Reactivity

Homo sapiens|Human

Target

Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol (By similarity) .

Type

Protein

Source

E.coli

Sequence

EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

45.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HSD11B1

Host or Source

Human

Protein Name

Corticosteroid 11-beta-dehydrogenase isozyme 1

Gene Name URL

HSD11B1

Nucleotide Accession Number

NM_001206741.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Transcription factor 4, TCF-4 ELISA Kit
YLA0164CA-01 48 Tests

Canine Transcription factor 4, TCF-4 ELISA Kit

Sign In for Pricing
View Details
Canine Transcription factor 4, TCF-4 ELISA Kit
YLA0164CA-02 96 Tests

Canine Transcription factor 4, TCF-4 ELISA Kit

Sign In for Pricing
View Details
Equine Actin Beta (ACTB) ELISA Kit-Competitive
EK1F590 96 Tests

Equine Actin Beta (ACTB) ELISA Kit-Competitive

Sign In for Pricing
View Details
FMO2 Recombinant Protein
OPCD00597-50UG 50 µg

FMO2 Recombinant Protein

Sign In for Pricing
View Details
MND1 Protein Vector (Mouse) (pPM-C-HA)
PV201368 500 ng

MND1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Matrix Metalloproteinase 3 (MMP-3, Stromelysin-1, SL-1, Transin) (BSA & Azide Free) (MaxLight 490) discontinued
M2421-29X-ML490 100 µL

Matrix Metalloproteinase 3 (MMP-3, Stromelysin-1, SL-1, Transin) (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details