Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HNRNPL Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Heterogeneous nuclear ribonucleoprotein L

Gene Aliases

Epididymis secretory sperm binding protein; heterogeneous nuclear ribonucleoprotein L; hnRNP L; hnRNP-L; HNRPL; P/OKcl.14.

Gene ID

3191

Accession Number

NP_001005335.1

Reactivity

Homo sapiens|Human

Target

Splicing factor binding to exonic or intronic sites and acting as either an activator or repressor of exon inclusion. Exhibits a binding preference for CA-rich elements (PubMed:11809897, PubMed:22570490, PubMed:24164894, PubMed:25623890, PubMed:26051023) . Component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes and associated with most nascent transcripts (PubMed:2687284) . Associates, together with APEX1, to the negative calcium responsive element (nCaRE) B2 of the APEX2 promoter (PubMed:11809897) .

Type

Protein

Source

E.coli

Sequence

GENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRPGDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEFDSVQSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHDEGYGP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HNRNPL

Host or Source

Human

Protein Name

Heterogeneous nuclear ribonucleoprotein L

Gene Name URL

HNRNPL

Nucleotide Accession Number

NM_001005335.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Liquid Petroleum Products Hydrocarbon Types Tester BPTL-269
BPTL-269 1 Unit

Liquid Petroleum Products Hydrocarbon Types Tester BPTL-269

Sign In for Pricing
View Details
FITC Conjugated Rabbit Anti-PNA Antibody
FAL-2301-2 2 mL

FITC Conjugated Rabbit Anti-PNA Antibody

Sign In for Pricing
View Details
ZBTB10 Human Gene Knockout Kit (CRISPR)
KN416891 1 Kit

ZBTB10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details