Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HIST1H2BB Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

H2B clustered histone 3

Gene Aliases

H2B histone family, member F; H2B.1; H2B/f; H2BFF; HIST1H2BB; histone 1, H2bb; histone cluster 1 H2B family member b; histone cluster 1, H2bb; histone H2B type 1-B; histone H2B.1; histone H2B.f.

Gene ID

3018

Accession Number

NP_066406.1

Reactivity

Homo sapiens|Human

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

29.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2BC3

Host or Source

Human

Protein Name

Histone H2B type 1-B

Gene Name URL

H2BC3

Nucleotide Accession Number

NM_021062.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM16K (ANO10) Human Gene Knockout Kit (CRISPR)
KN415283 1 Kit

TMEM16K (ANO10) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TYK2 Rabbit Polyclonal Antibody
AP02648PU-N 100 µL

TYK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ubiquitin Recombinant Rabbit monoclonal Antibody
HA750165 100 µL

Ubiquitin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ATP1B4 (NM_012069) Human Recombinant Protein
TP324408 20 µg

ATP1B4 (NM_012069) Human Recombinant Protein

Sign In for Pricing
View Details
Biglycan (BGN) Human Gene Knockout Kit (CRISPR)
KN400715 1 Kit

Biglycan (BGN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NARF (NM_001038618) Human Over-expression Lysate
LC422003 20 µg

NARF (NM_001038618) Human Over-expression Lysate

Sign In for Pricing
View Details