Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDF9 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Growth differentiation factor 9

Gene Aliases

Growth/differentiation factor 9; POF14.

Gene ID

2661

Accession Number

NP_001275753.1

Reactivity

Homo sapiens|Human

Target

Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells.

Type

Protein

Source

E.coli

Sequence

GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GDF9

Host or Source

Human

Protein Name

Growth/differentiation factor 9

Gene Name URL

GDF9

Nucleotide Accession Number

NM_001288824.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INADL Polyclonal Antibody
27604-01 50 µL

INADL Polyclonal Antibody

Sign In for Pricing
View Details
INADL Polyclonal Antibody
27604-02 100 µL

INADL Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal IL-33 Antibody (396118) [Alexa Fluor 488]
FAB3626G 0.1 mL

Rat Monoclonal IL-33 Antibody (396118) [Alexa Fluor 488]

Sign In for Pricing
View Details
ATL1 siRNA (Human)
CRH9486-01 15 nmol

ATL1 siRNA (Human)

Sign In for Pricing
View Details
ATL1 siRNA (Human)
CRH9486-02 30 nmol

ATL1 siRNA (Human)

Sign In for Pricing
View Details
Asxl2 3'UTR Luciferase Stable Cell Line
TU102240 1.0 mL

Asxl2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details